20cm3 of 2m citric acid solution containing the demulsifier see note below to prepare c
Tài liệu Báo cáo Y học: Evolution of the enzymes of the citric acid cycle and the glyoxylate cycle of higher plants pdf
... designed to account for the origins of eukaryotes and their genes The eukaryotic tricarboxylic acid cycle: an inhertance from eubacteria, but from which? The tricarboxylic acid cycle is a speci®cally ... the citric acid cycle (Krebs cycle, or tricarboxylic acid cycle) is an important pathway in that it is the primary source of electrons (usually stemming from pyruvate) donated to the respiratory ... acid cycle, which contains most of the same activities as the tricarboxylic acid cycle, as a major pathway of central carbon metabolism [79] In no case were the eukaryotic enzymes speci®cally...
- 16
- 474
- 0
Báo cáo khoa học: Discovery of GSK837149A, an inhibitor of human fatty acid synthase targeting the b-ketoacyl reductase reaction pot
... controls treated similarly in the absence of compound The values in the horizontal axis correspond to the concentration of compound in the sample before any concentration and dilution cycle The ... fact, most of them act irreversibly through covalent bond formation due to the high chemical reactivity of the molecules rather than to their similarity with intermediates of the enzymatic reaction, ... acetoacetyl-CoA Nonetheless, the result may also have implications for understanding the mechanism that FAS utilizes to carry out each catalytic cycle, suggesting that the growing ketoacyl–ACP...
- 12
- 391
- 0
Báo cáo khoa học: Structural and functional consequences of single amino acid substitutions in the pyrimidine base binding pocket of Escherichia coli CMP kinase pdf
... AATTGCACCTGCGTCCAGCAGATG; R110M: TAATGCTTCCATAACGCGTGGGAA; D132A: CGTTC CCATTGCGCGGCCATCGGC; D132H: TACCACCGT TCCCATATGGCGGCCATCGGCAAT; D132N: TACCAC D132S: CGTTCCCATATTGCGGCCATCGGCAAT; TAC CACGTTCCCATGGAGCGGCCATCGGCAAT; ... CGTTCCCATATTGCGGCCATCGGCAAT; TAC CACGTTCCCATGGAGCGGCCATCGGCAAT; R188M: CGCTACCGCCATGTTACGATCGCG For each mutagenesis, the whole sequence of the cmk gene was checked for the absence of any other mutation [26] Plasmid ... specificity of E coli CMP kinase binding network surrounding the cytosine moiety in the specificity of the enzyme for the acceptor nucleotide Because this specificity is characteristic of bacterial...
- 11
- 437
- 0
Báo cáo y học: " Role of taurine on acid secretion in the rat stomach" ppsx
... regulate acid secretion through A- type GABA receptors and elevation of cAMP in the stomach The distribution of taurine -containing cells in the rat stomach was localized immunohistochemically using ... taurine-positive cells We found the presence of taurine -containing cells and taurine-induced acid secretion in the stomach In the body of the stomach, taurine-immunoreactive cells were observed along the ... by the release of ACh The ACh-binding M3 receptors exist on the membranes of parietal cells Extracellular Ca 2+ appears to be an important factor in the control of gastric secretion [51] Conclusions...
- 10
- 490
- 1
A study on the semantic features of english collocations containing the verb “make” with reference to their vietnamese equivalents
... as in: racing circuit, lecture circuit, talk-show circuit, short circuit, closed circuit… 30 Collocations are Arbitrary According to Kathleen R McKeown and Dragomir R Radev, the notion of arbitrariness ... free combinations are loosely fixed combinations (or collocations) of the type to commit murder The main characteristics of collocations are that their meanings reflect the meaning of their constituent ... but a lack of collocations” Along with Hill, McCarthy (1990:12) claims that “collocation deserves to be a central aspect of vocabulary study.” These pieces of evidence done can show the great...
- 79
- 850
- 6
Báo cáo khoa học: Structure of Streptococcus agalactiae serine⁄threonine phosphatase The subdomain conformation is coupled to the binding of a third metal ion pptx
... However, the most important reason to doubt the presence of an M3 site in eukaryotic STPs concerns the presence of a general acid In HsSTP, His62 has been shown to be the general acid protonating the ... the active site The differential occurrence of the metal ions correlates with the conformation of the flap subdomain (132–174) and the ‘binding’ of adjacent STP monomers over the active sites of ... performed using the molrep [30] program of the ccp4 package [30,31] using the ccp4i graphical interface [32] The Matthews coefficient [28] indicated four monomers in the ˚ asymmetric unit (Vm ẳ 2.7...
- 10
- 542
- 0
RESEARCH ON EXTRACTED HYDROXYCITRIC ACID COLLECTION FROM THE GARCINIA COWA ROXB RINDS TO MAKE DOUBLE SALT HYDROXYCITRATE SALT FOR OBESITY REDUCING APPLICATION
... data, the content of hydroxycitric acid accounts for 27,1%, so in the near future, the Garcinia cowa Roxb will be used as a source of raw materials for the purpose of extracting hydroxycitric acid ... scientific researches and material areas with sufficiently high yields to implement the application, we chose the topic "Research on extracted hydroxycitric acid collection from the Garcinia cowa ... mostly hydroxycitric acid (HCA) (accounting from 23% to 25% in dry fruit shells), with small and unremarkable amounts of compounds such as lactone of hydroxycitric acid, oxalic acid, flavonoid...
- 28
- 77
- 0
A study on the english collocation containing the verb SET with reference to their vietnamese equivalents
... lack of collocations Along with Hill, McCarthy (1990) claims that collocation deserves to be a central aspect of vocabulary study These pieces of evidence done can show the great importance of ... were collected in order to make the corpus of this thesis Secondly, statistics on the number of the collocation containing the verb Set Classifying them into the group means, group structures ... syntactic features of the collocation of the verb Set in order to help the English teachers and learners use the meanings and structure of the English collocation containing the verb Set exactly...
- 97
- 596
- 4
Báo cáo khóa học: Characterization of Mesorhizobium huakuii lipid A containing both D-galacturonic acid and phosphate residues ppt
... with the exception of H-4 and C- 4 in distal DAG The absence of phosphate caused an upfield shift of both proton HC-4 and carbon CC-4 These values of chemical shifts became similar to the corresponding ... conclusion that the 27-hydroxyoctacosanoic acid and eicosanoic acid, when present, are located on the distal diaminoglucosyl residue of the lipid A Moreover, the sugar component of B1+ lacks ... C for h The reaction mixtures, after cooling, were poured into cold acetone The resulting lipid A precipitates were collected, washed twice with acetone and then gently dried in the stream of...
- 13
- 428
- 0
Báo cáo khoa học: Characterization of D-amino-acid-containing excitatory conotoxins and redefinition of the I-conotoxin superfamily pot
... work CRAEGTYCENDSQCCLNECCWGGCGHPCRHPGKRSKLQEFFRQR CRAgGTYCgNDSQCCLNgCCWGGCGHOCRHP* SRCFPPGIYCTSYLPCCWGICCSTCRNVCHLRIGKRATFQE SRCFPPGIYCTSYLPCCWGICCSTCRNVCHLRIGK^ CFPPGIYCTPYLPCCWGICCGTCRNVCHLRIGKRATFQE ... GPSFCKANGKPCSYHADCCNCCLSGICKPSTNVILPGCSTSSFFRI GOSFCKANGKOCSYHADCCNCCLSGICKOSTNVILPGCSTSSFFRI^ C radiatus R11.4 ⁄ r1 1c GPSFCKADEKPCKYHADCCNCCLGGICKPSTSWI GCSTNVFLTR GOSFCKADEKOCKYHADCCNCCLGGICKOSTSWI ... GCSTNVFLT^ C figulinus Fi11.1a GHVSCGKDGRACDYHADCCNCCLGGICKPSTSWI GCSTNVFLTR C magus M11.1a GAVPCGKDGRQCRNHADCCNCCPIGTCAPSTNWILPGCSTGQFMTR C striatus S11.2a GCKKDRKPCSYQADCCNCCPIGTCAPSTNWILPGCSTGPFMAR...
- 11
- 336
- 0
Density and hardness of negative pastes of lead–acid batteries containing organic additives with or without quinone structure pdf
... 1,2-naphthoquinone-4-sulfonic acid sodium salt (NQS) On the other hand, after the addition of sulfuric acid solution (result 2), the paste containing NS was less dense and softer than that containing NQS ... means of the stick insertion depth test It is found that not only the existence of quinone structures in the organic additives but also the total structure of organic additives affects the density ... it is not only the existence of quinone structures in organic additives but also the total structure of the organic additives that affect the density and hardness of the paste Acknowledgement...
- 4
- 637
- 0
Báo cáo y học: "Inhibition of citric acid- and capsaicin-induced cough by novel TRPV-1 antagonist, V112220, in guinea-pig" potx
... Pre-screen Citric Acid Capsaicin 20 15 10 Pre-screen Citric Acid Capsaicin Figure 1of coughs per 10 in conscious guinea-pigs on pre-screen, following exposure to citric acid and to capsaicin Number ... antagonists such as iodo-resiniferatoxin and BCTC that have shown inhibition of cough induced by citric acid and capsaicin in the guinea-pig [14,15] Capsaicin Citric Acid 25 20 15 10 ** Control Vehicle ... Number of Coughs Number of Coughs 25 20 15 10 * Control Vehicle n=4 n=5 V112220 n=5 Figure Number 2of coughs following citric acid or capsaicin exposure Number of coughs following citric acid or capsaicin...
- 5
- 301
- 0
Báo cáo y học: "validation of the ERS standard citric acid cough challenge in healthy adult volunteers" pps
... inhalation of each concentration of citric acid; between each inhalation was a 30 second interval The cough response during the first 15 seconds of this interval was recorded The concentration at which ... ml/s Each volunteer received four inhalations of each concentration of citric acid; each of one second duration, between each inhalation was a 30 second interval The cough response for the first ... in physiological saline to produce incremental concentrations of citric acid (1, 3, 10, 30, 100, 300, 1000 mM) Fresh dilutions of stock solution were made on each day of testing The solutions were...
- 8
- 233
- 0
Báo cáo y học: "Aging deteriorated perception of urge-to-cough without changing cough reflex threshold to citric acid in female never-smokers" ppt
... of citric acid that elicited five or more coughs (C5 ) (B) The urge -to- cough estimated by the Borg scores at C5 of each subject (C) The urge -to- cough estimated by the Borg scores at the concentration ... expressed as the log transformation of the lowest concentration of citric acid that elicited five or more coughs (C2 ) (B) The urge -to- cough estimated by the Borg scores at C2 of each subject (C) The urge -to- cough ... estimated by the lowest concentration of citric acid that elicited two or more coughs (C2 ) and the lowest concentration of citric acid that elicited five or more coughs (C5 ) during minute, respectively...
- 6
- 198
- 0
Báo cáo y học: "Prescription profile of potentially aristolochic acid containing Chinese herbal products: an analysis of National Health Insurance data in Taiwan between 1997 and 2003." ppsx
... of the analogue of aristolochic acid and aristolactam in the plant of aristolochia genus by HPLC J Food Drug Anal 2004, 12(1):40-45 Schaneberg BT, Khan IA: Analysis of products suspected of containing ... acid; CHPs: Chinese herbal products; AACHPs: CHPs containing AA; NHI: National Health Insurance; CCMP: Committee on Chinese Medicine and Pharmacy Competing interests The authors declare that they ... 17(4):265-277 Cosyns JP: Aristolochic acid and 'Chinese herbs nephropathy': a review of the evidence to date Drug Saf 2003, 26(1):33-48 Cosyns JP: Human and experimental features of aristolochic acid nephropathy...
- 6
- 335
- 0
Oxidation of Pyruvate and the Citric Acid Cycle
... occur, the oxidation steps of the citric acid cycle also not occur Note that the citric acid cycle produces very little ATP directly and does not directly consume oxygen In the citric acid cycle, ... acid cycle here Products of the Citric Acid Cycle Two carbon atoms come into the citric acid cycle from each acetyl group, representing four out of the six carbons of one glucose molecule Two carbon ... (for the first intermediate formed citric acid, or citrate—when acetate joins to the oxaloacetate), the TCA cycle (since citric acid or citrate and isocitrate are tricarboxylic acids), and the...
- 7
- 156
- 0
LINH DAM NEW TOWN - SOLUTION FOR THE HIGH-DENSITY DEVELOPMENT OF NEW SETTLEMENTS IN THE SOUTH-WEST OF HANOI
... public spaces and social services - The hierarchy of the public spaces: between the streets to preserve the security of circulation, the pollution and noise; between the common and green spaces, to ... Town, combined to the “natural” landscape and green space, and created a motivation for the development of the southern gateway of Hanoi capital Since 22 - 01 - 2009, the Minister of Construction ... strategy to control the spontaneous building and visual complexity characterizing the cityscape of Hanoi and to increase the number of flats between 2000 and 2010 Accordingly, HUD introduced the term...
- 10
- 805
- 3
LINH DAM NEW TOWN - SOLUTION FOR THE HIGH-DENSITY DEVELOPMENT OF NEW SETTLEMENTS IN THE SOUTH-WEST OF HANOI
... vi c làm, đời sống lao động nữ nông thôn làm c ng vi c tự Hà Nội để từ đề xuất số giải pháp giúp lao động c sống, c ng vi c thuận lợi C CH TIẾP C N VÀ PHƯƠNG PHÁP Hai c ch tiếp c n tiếp c n c ... truyền t c hại tệ nạn xã hội để họ chủ động phòng tránh Chính sách Chính phủ: C n c nhiều sách quan tâm đến đời sống, vi c làm lao động nữ nông thôn làm vi c tự Hà Nội C c sách đưa c n xem xét, ... c ng s c mà họ bỏ 3.1.4 M c độ hài lòng với c ng vi c 59,05% lao động cho biết c ng vi c chấp nhận Vì lao động làm vi c Hà Nội kinh tế gia đình họ c phần c i thiện 16,19% lao động giúp vi c “hài...
- 8
- 654
- 0
Tìm thêm: hệ việt nam nhật bản và sức hấp dẫn của tiếng nhật tại việt nam xác định các mục tiêu của chương trình xác định các nguyên tắc biên soạn khảo sát chương trình đào tạo của các đơn vị đào tạo tại nhật bản khảo sát chương trình đào tạo gắn với các giáo trình cụ thể xác định thời lượng học về mặt lí thuyết và thực tế điều tra đối với đối tượng giảng viên và đối tượng quản lí khảo sát thực tế giảng dạy tiếng nhật không chuyên ngữ tại việt nam phát huy những thành tựu công nghệ mới nhất được áp dụng vào công tác dạy và học ngoại ngữ mở máy động cơ lồng sóc hệ số công suất cosp fi p2 đặc tuyến hiệu suất h fi p2 đặc tuyến tốc độ rôto n fi p2 đặc tuyến dòng điện stato i1 fi p2 động cơ điện không đồng bộ một pha sự cần thiết phải đầu tư xây dựng nhà máy phần 3 giới thiệu nguyên liệu từ bảng 3 1 ta thấy ngoài hai thành phần chủ yếu và chiếm tỷ lệ cao nhất là tinh bột và cacbonhydrat trong hạt gạo tẻ còn chứa đường cellulose hemicellulose chỉ tiêu chất lượng theo chất lượng phẩm chất sản phẩm khô từ gạo của bộ y tế năm 2008 chỉ tiêu chất lượng 9 tr 25